PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C00913.1.p
Common NameEUGRSUZ_C00913
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HRT-like
Protein Properties Length: 566aa    MW: 61868.3 Da    PI: 9.7671
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C00913.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like54.51.9e-17283312130
          HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                       iCGv  edG +C+++Pv+g KRC eHKGmR
  Eucgr.C00913.1.p 283 ICGVVSEDGFPCTKPPVQGSKRCGEHKGMR 312
                       8***************************** PP

2HRT-like58.51.1e-18361391131
          HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                       iCGv  edG +C+++Pv+gRKRC eHKGmRi
  Eucgr.C00913.1.p 361 ICGVVPEDGFPCTKPPVQGRKRCDEHKGMRI 391
                       8*****************************7 PP

3HRT-like61.11.7e-19450480131
          HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                       iCGvil+dG +C+++Pv+gRKRC eHKGmRi
  Eucgr.C00913.1.p 450 ICGVILKDGFPCTKPPVQGRKRCGEHKGMRI 480
                       8*****************************7 PP

4HRT-like50.14.6e-16534564131
          HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                       +CGv  +dG +C+r Pv+gR RCe HKGmR+
  Eucgr.C00913.1.p 534 VCGVDFGDGMFCTRRPVRGRVRCEHHKGMRV 564
                       7*****************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MERGDPNVVA VARLRREDCE RTKHDSAFAT WKVLVGPTDW EDYSLGKEGA ARYRVHNLPK  60
SPGPGIYELG VAAPRAKLGR EIAKLDLRYI VVVYLGKADC VRTRLQQYGR SGAHLGRCSS  120
AACEIDCKTS CPTKQLGLFE EVLSRGYPIM FRWASLNNKG DAQRTELSLL NTFDYAWNKG  180
SNGSRRPGDI FQKLDEIASS TYCISGIARK LLPIRPRQVG IRINGKLLSE KDSFPQTGGE  240
SSNSLNRIFK FSKSRPRLVI SESHANDTAI LGTSPANESF SPICGVVSED GFPCTKPPVQ  300
GSKRCGEHKG MRLQASNSVL SRKGASNGIH DKPTVIIVIS ESHANDTVIL GKCPSIESSP  360
ICGVVPEDGF PCTKPPVQGR KRCDEHKGMR IPVSDTVSSR RGASNGIHNN LTRTSWDHTA  420
ESRPRLVISE SHANGTAISG TCPSIESSPI CGVILKDGFP CTKPPVQGRK RCGEHKGMRI  480
QASESVSSRR GASNGIHDKL TRTSWDHTAK IHELGNIVEV FPQQVDVKNN YGSVCGVDFG  540
DGMFCTRRPV RGRVRCEHHK GMRVR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C00913.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010047598.10.0PREDICTED: uncharacterized protein LOC104436504
TrEMBLA0A059CNP10.0A0A059CNP1_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29542763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.17e-96effector of transcription2